PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_21957
Common NameKK1_022609
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 243aa    MW: 28478.3 Da    PI: 10.3226
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_21957genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.3e-172369148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ed  lv++vk++G + W+ Iar ++ gR +kqc++rw+++l
    C.cajan_21957 23 KGQWSADEDRVLVQLVKRFGLKKWSQIARLLN-GRIGKQCRERWHNHL 69
                     799*****************************.*************97 PP

2Myb_DNA-binding59.28.9e-1975117145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +W++eEd+ l++a+k+lG++ W+ Iar+m+ gR+++ +k++w+
    C.cajan_21957  75 KESWSEEEDKVLIEAHKELGNK-WAEIARRMP-GRSENTIKNHWN 117
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.8071873IPR017930Myb domain
SuperFamilySSF466891.95E-3120116IPR009057Homeodomain-like
SMARTSM007172.8E-152271IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-252475IPR009057Homeodomain-like
PfamPF139212.8E-182684No hitNo description
CDDcd001671.01E-122669No hitNo description
PROSITE profilePS5129420.96274124IPR017930Myb domain
SMARTSM007174.2E-1674122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2176122IPR009057Homeodomain-like
CDDcd001678.58E-1277120No hitNo description
Gene3DG3DSA:3.30.1890.104.2E-4131168No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MNNQVQRRSI TVKFQNQISN IIKGQWSADE DRVLVQLVKR FGLKKWSQIA RLLNGRIGKQ  60
CRERWHNHLR PNIRKESWSE EEDKVLIEAH KELGNKWAEI ARRMPGRSEN TIKNHWNATK  120
RRLYARKQRI KRTTSKGATT LLQSYIRQVT EAENNHLNKP INNNLHQRPY RVRYESSEGG  180
FTSEEEEPAW HRHLPVANDD YVPVMLTSEE MATASAVEAG AVDYGVAMEK EMDLMEMIYR  240
KAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-45181222106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140966.11e-104hypothetical protein PHAVU_008G156100g
SwissprotQ9S7L26e-61MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A151TPJ20.0A0A151TPJ2_CAJCA; Transcription factor MYB98
STRINGGLYMA19G13923.11e-96(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-62myb domain protein 98